General Information

  • ID:  hor006600
  • Uniprot ID:  Q9PTQ4
  • Protein name:  Urophysin
  • Gene name:  NA
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TCRPRDLSLVNSQLDDVLSNGAGDDAMSYLVGEKLLQYLQRNLGAQKASGVLHLPHFPAAQLRSPHEDSSLEELTEFS
  • Length:  78
  • Propeptide:  MKPVPLVLLITSVLLTTHIPLSTCRPRDLSLVNSQLDDVLSNGAGDDAMSYLVGEKLLQYLQRNLGAQKASGVLHLPHFPAAQLRSPHEDSSLEELTEFSKRNDDPPISIDLTFHLLRNMIEMARNENQREQAGLNRKYLDEVGK
  • Signal peptide:  MKPVPLVLLITSVLLTTHIPLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PTQ4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006600_AF2.pdbhor006600_ESM.pdb

Physical Information

Mass: 992517 Formula: C371H590N106O122S2
Absent amino acids: IW Common amino acids: L
pI: 4.66 Basic residues: 9
Polar residues: 22 Hydrophobic residues: 26
Hydrophobicity: -39.36 Boman Index: -14458
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 92.56
Instability Index: 5495.9 Extinction Coefficient cystines: 2980
Absorbance 280nm: 38.7

Literature

  • PubMed ID:  10603283
  • Title:  Differential expression of corticotropin-releasing factor (CRF) and urotensin I precursor genes, and evidence of CRF gene expression regulated by cortisol in goldfish brain.